Enkephalin (PENK) (NM_006211) Human Mass Spec Standard
CAT#: PH307563
PENK MS Standard C13 and N15-labeled recombinant protein (NP_006202)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207563 |
| Predicted MW | 30.8 kDa |
| Protein Sequence |
>RC207563 protein sequence
Red=Cloning site Green=Tags(s) MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_006202 |
| RefSeq Size | 1221 |
| RefSeq ORF | 801 |
| Synonyms | enkephalin A; preproenkephalin; proenkephalin |
| Locus ID | 5179 |
| Cytogenetics | 8q12.1 |
| Summary | 'This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015]' |
| Protein Families | Secreted Protein |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401880 | PENK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427669 | PENK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401880 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 2 |
USD 436.00 |
|
| LY427669 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 1 |
USD 436.00 |
|
| PH327805 | PENK MS Standard C13 and N15-labeled recombinant protein (NP_001129162) |
USD 2,055.00 |
|
| TP307563 | Recombinant protein of human proenkephalin (PENK), transcript variant 2 |
USD 823.00 |
|
| TP327805 | Recombinant protein of human proenkephalin (PENK), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China