Enkephalin (PENK) (NM_001135690) Human Mass Spec Standard

CAT#: PH327805

PENK MS Standard C13 and N15-labeled recombinant protein (NP_001129162)

Product Images

Coomassie blue staining of purified PENK protein (Cat# TP327805). The protein was produced from HEK293T cells transfected with PENK cDNA clone (Cat# RC227805) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227805
• Predicted MW: 30.8 kDa
• Protein Sequence:
  Sequence Link

  >RC227805 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ
  LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM
  KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY
  GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129162
• RefSeq Size: 1354
• RefSeq ORF: 801
• Synonyms: PE; PENK-A
• Locus ID: 5179
• UniProt ID: P01210, A0A024R7V4
• Cytogenetics: 8q12.1
• Summary: 'This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015]'
• Protein Families: Secreted Protein