Spasmolytic Polypeptide (TFF2) (NM_005423) Human Mass Spec Standard

CAT#: PH307571

TFF2 MS Standard C13 and N15-labeled recombinant protein (NP_005414)

Product Images

Coomassie blue staining of purified TFF2 protein (Cat# TP307571). The protein was produced from HEK293T cells transfected with TFF2 cDNA clone (Cat# RC207571) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207571
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Sequence Link

  >RC207571 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF
  HPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005414
• RefSeq Size: 717
• RefSeq ORF: 387
• Synonyms: SML1; SP
• Locus ID: 7032
• UniProt ID: Q03403
• Cytogenetics: 21q22.3
• Summary: 'Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein