Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein

CAT#: TP723435

Purified recombinant protein of Human trefoil factor 2 (TFF2).

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  AEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
• Tag: Tag Free
• Predicted MW: 12 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay #1: Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ug/ml. Assay #2: Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1.0-10.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005414
• Locus ID: 7032
• UniProt ID: Q03403
• Cytogenetics: 21q22.3
• Refseq Size: 717
• Refseq ORF: 387
• Synonyms: SML1; SP
• Summary: 'Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein