Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein

CAT#: TP307571

Recombinant protein of human trefoil factor 2 (TFF2)

Product Images

Coomassie blue staining of purified TFF2 protein (Cat# TP307571). The protein was produced from HEK293T cells transfected with TFF2 cDNA clone (Cat# RC207571) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207571 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF
  HPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005414
• Locus ID: 7032
• UniProt ID: Q03403
• Cytogenetics: 21q22.3
• Refseq Size: 717
• Refseq ORF: 387
• Synonyms: SML1; SP
• Summary: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein