G CSF (CSF3) (NM_172220) Human Mass Spec Standard

CAT#: PH307709

CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_757374)

Product Images

Coomassie blue staining of purified CSF3 protein (Cat# TP307709). The protein was produced from HEK293T cells transfected with CSF3 cDNA clone (Cat# RC207709) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207709
• Predicted MW: 21.5 kDa
• Protein Sequence:
  Sequence Link

  >RC207709 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHP
  EELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFA
  TTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_757374
• RefSeq Size: 1494
• RefSeq ORF: 600
• Synonyms: C17orf33; CSF3OS; GCSF
• Locus ID: 1440
• UniProt ID: P09919, Q8N4W3
• Cytogenetics: 17q21.1
• Summary: 'This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway