G CSF (CSF3) (NM_172220) Human Mass Spec Standard
CAT#: PH307709
CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_757374)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207709 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC207709 protein sequence
Red=Cloning site Green=Tags(s) MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHP EELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFA TTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_757374 |
RefSeq Size | 1494 |
RefSeq ORF | 600 |
Synonyms | C17orf33; CSF3OS; GCSF |
Locus ID | 1440 |
UniProt ID | P09919, Q8N4W3 |
Cytogenetics | 17q21.1 |
Summary | 'This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400258 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC403533 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432626 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400258 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1 |
USD 325.00 |
|
LY403533 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
USD 325.00 |
|
LY432626 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4 |
USD 325.00 |
|
PH317237 | CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_000750) |
USD 2,055.00 |
|
TP307709 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
USD 439.00 |
|
TP317237 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1 |
USD 748.00 |
|
TP329626 | Purified recombinant protein of Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4. |
USD 748.00 |
|
TP720002 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1, produced in E. coli |
USD 300.00 |
|
TP723127 | Purified recombinant protein of Human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1. |
USD 240.00 |
|
TP723770 | Purified recombinant protein of Human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
USD 265.00 |
{0} Product Review(s)
Be the first one to submit a review