G CSF (CSF3) (NM_172220) Human Recombinant Protein

CAT#: TP307709

Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3

Product Images

Coomassie blue staining of purified CSF3 protein (Cat# TP307709). The protein was produced from HEK293T cells transfected with CSF3 cDNA clone (Cat# RC207709) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207709 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHP
  EELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFA
  TTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_757374
• Locus ID: 1440
• UniProt ID: P09919, Q8N4W3
• Cytogenetics: 17q21.1
• Refseq Size: 1494
• Refseq ORF: 600
• Synonyms: C17orf33; CSF3OS; GCSF
• Summary: This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway