Peroxiredoxin 6 (PRDX6) (NM_004905) Human Mass Spec Standard

CAT#: PH307780

PRDX6 MS Standard C13 and N15-labeled recombinant protein (NP_004896)

Product Images

Coomassie blue staining of purified PRDX6 protein (Cat# TP307780). The protein was produced from HEK293T cells transfected with PRDX6 cDNA clone (Cat# RC207780) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207780
• Predicted MW: 25 kDa
• Protein Sequence:
  Sequence Link

  >RC207780 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA
  LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD
  KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE
  LPSGKKYLRYTPQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004896
• RefSeq Size: 1715
• RefSeq ORF: 672
• Synonyms: 1-Cys; aiPLA2; AOP2; HEL-S-128m; NSGPx; p29; PRX
• Locus ID: 9588
• UniProt ID: P30041, V9HWC7
• Cytogenetics: 1q25.1
• Summary: The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Methane metabolism, Phenylalanine metabolism