Peroxiredoxin 6 (PRDX6) (NM_004905) Human Recombinant Protein
CAT#: TP307780
Recombinant protein of human peroxiredoxin 6 (PRDX6)
View other "PRDX6" proteins (4)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207780 protein sequence
Red=Cloning site Green=Tags(s) MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE LPSGKKYLRYTPQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004896 |
| Locus ID | 9588 |
| UniProt ID | P30041, V9HWC7 |
| Cytogenetics | 1q25.1 |
| Refseq Size | 1715 |
| Refseq ORF | 672 |
| Synonyms | 1-Cys; aiPLA2; AOP2; HEL-S-128m; LPCAT-5; NSGPx; p29; PRX |
| Summary | The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Methane metabolism, Phenylalanine metabolism |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401530 | PRDX6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401530 | Transient overexpression lysate of peroxiredoxin 6 (PRDX6) |
USD 436.00 |
|
| PH307780 | PRDX6 MS Standard C13 and N15-labeled recombinant protein (NP_004896) |
USD 2,055.00 |
|
| TP720510 | Recombinant protein of human peroxiredoxin 6 (PRDX6) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China