Calcyon (CALY) (NM_015722) Human Mass Spec Standard

CAT#: PH307894

CALY MS Standard C13 and N15-labeled recombinant protein (NP_056537)

Product Images

Coomassie blue staining of purified CALY protein (Cat# TP307894). The protein was produced from HEK293T cells transfected with CALY cDNA clone (Cat# RC207894) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207894
• Predicted MW: 23.4 kDa
• Protein Sequence:
  Sequence Link

  >RC207894 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQ
  RLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPER
  HRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGS
  AAPPPAQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056537
• RefSeq Size: 983
• RefSeq ORF: 651
• Synonyms: DRD1IP; NSG3
• Locus ID: 50632
• UniProt ID: Q9NYX4
• Cytogenetics: 10q26.3
• Summary: The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane