Calcyon (CALY) (NM_015722) Human Recombinant Protein

CAT#: TP307894

Recombinant protein of human calcyon neuron-specific vesicular protein (CALY)

Product Images

Coomassie blue staining of purified CALY protein (Cat# TP307894). The protein was produced from HEK293T cells transfected with CALY cDNA clone (Cat# RC207894) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207894 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQ
  RLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPER
  HRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGS
  AAPPPAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056537
• Locus ID: 50632
• UniProt ID: Q9NYX4
• Cytogenetics: 10q26.3
• Refseq Size: 983
• Refseq ORF: 651
• Synonyms: DRD1IP; NSG3
• Summary: The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane