DCUN1D3 (NM_173475) Human Mass Spec Standard

CAT#: PH308082

DCUN1D3 MS Standard C13 and N15-labeled recombinant protein (NP_775746)

Product Images

Coomassie blue staining of purified DCUN1D3 protein (Cat# TP308082). The protein was produced from HEK293T cells transfected with DCUN1D3 cDNA clone (Cat# RC208082) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208082
• Predicted MW: 34.3 kDa
• Protein Sequence:
  Sequence Link

  >RC208082 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT
  SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC
  KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK
  LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER
  RKREGEGRGALSSGPEGLCPEEQT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775746
• RefSeq Size: 2886
• RefSeq ORF: 912
• Synonyms: 44M2.4; SCCRO3
• Locus ID: 123879
• UniProt ID: Q8IWE4
• Cytogenetics: 16p12.3