DCUN1D3 (NM_173475) Human Recombinant Protein

CAT#: TP308082

Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3)

Product Images

Coomassie blue staining of purified DCUN1D3 protein (Cat# TP308082). The protein was produced from HEK293T cells transfected with DCUN1D3 cDNA clone (Cat# RC208082) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208082 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT
  SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC
  KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK
  LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER
  RKREGEGRGALSSGPEGLCPEEQT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_775746
• Locus ID: 123879
• UniProt ID: Q8IWE4
• Cytogenetics: 16p12.3
• Refseq Size: 2886
• Refseq ORF: 912
• Synonyms: 44M2.4; SCCRO3
• Summary: Antagonizes DCUN1D1-mediated CUL1 neddylation by sequestering CUL1 at the cell membrane (PubMed:25349211). When overexpressed in transformed cells, may promote mesenchymal to epithelial-like changes and inhibit colony formation in soft agar (PubMed:25349211).[UniProtKB/Swiss-Prot Function]