UBXD3 (UBXN10) (NM_152376) Human Mass Spec Standard

CAT#: PH308225

UBXN10 MS Standard C13 and N15-labeled recombinant protein (NP_689589)

Product Images

Coomassie blue staining of purified UBXN10 protein (Cat# TP308225). The protein was produced from HEK293T cells transfected with UBXN10 cDNA clone (Cat# RC208225) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208225
• Predicted MW: 30.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208225 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATEAPVNIAPPECSTVVSTAVDSLIWQPNSLNMHMIRPKSAKGRTRPSLQKSQGVEVCAHHIPSPPPAI
  PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSINRKNLEEEAVETVAKKASSL
  QLSSIRALYQDETGTMKTSEEDSRARACAVERKFIVRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQR
  FVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGWP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689589
• RefSeq Size: 2987
• RefSeq ORF: 840
• Synonyms: UBXD3
• Locus ID: 127733
• UniProt ID: Q96LJ8
• Cytogenetics: 1p36.12
• Summary: VCP/p97-binding protein required for ciliogenesis (PubMed:26389662). Acts as a tethering factor that facilitates recruitment of VCP/p97 to the intraflagellar transport complex B (IFT-B) in cilia (PubMed:26389662). UBX domain-containing proteins act as tethering factors for VCP/p97 and may specify substrate specificity of VCP/p97 (PubMed:26389662). [UniProtKB/Swiss-Prot Function]