UBXD3 (UBXN10) (NM_152376) Human Recombinant Protein

CAT#: TP308225

Recombinant protein of human UBX domain protein 10 (UBXN10)

Product Images

Coomassie blue staining of purified UBXN10 protein (Cat# TP308225). The protein was produced from HEK293T cells transfected with UBXN10 cDNA clone (Cat# RC208225) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208225 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATEAPVNIAPPECSTVVSTAVDSLIWQPNSLNMHMIRPKSAKGRTRPSLQKSQGVEVCAHHIPSPPPAI
  PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSINRKNLEEEAVETVAKKASSL
  QLSSIRALYQDETGTMKTSEEDSRARACAVERKFIVRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQR
  FVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGWP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689589
• Locus ID: 127733
• UniProt ID: Q96LJ8
• Cytogenetics: 1p36.12
• Refseq Size: 2987
• Refseq ORF: 840
• Synonyms: UBXD3
• Summary: VCP/p97-binding protein required for ciliogenesis (PubMed:26389662). Acts as a tethering factor that facilitates recruitment of VCP/p97 to the intraflagellar transport complex B (IFT-B) in cilia (PubMed:26389662). UBX domain-containing proteins act as tethering factors for VCP/p97 and may specify substrate specificity of VCP/p97 (PubMed:26389662).[UniProtKB/Swiss-Prot Function]