PTER (NM_001001484) Human Mass Spec Standard

CAT#: PH308362

PTER MS Standard C13 and N15-labeled recombinant protein (NP_001001484)

Product Images

Coomassie blue staining of purified PTER protein (Cat# TP308362). The protein was produced from HEK293T cells transfected with PTER cDNA clone (Cat# RC208362) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208362
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC208362 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKEN
  LQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAM
  SVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPF
  QIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRR
  VRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001001484
• RefSeq Size: 3826
• RefSeq ORF: 1047
• Synonyms: HPHRP; RPR-1
• Locus ID: 9317
• UniProt ID: Q96BW5
• Cytogenetics: 10p13