PTER (NM_001001484) Human Recombinant Protein

CAT#: TP308362

Recombinant protein of human phosphotriesterase related (PTER), transcript variant 1

Product Images

Coomassie blue staining of purified PTER protein (Cat# TP308362). The protein was produced from HEK293T cells transfected with PTER cDNA clone (Cat# RC208362) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208362 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKEN
  LQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAM
  SVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPF
  QIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRR
  VRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001001484
• Locus ID: 9317
• UniProt ID: Q96BW5
• Cytogenetics: 10p13
• Refseq Size: 3826
• Refseq ORF: 1047
• Synonyms: HPHRP; RPR-1