LXR beta (NR1H2) (NM_007121) Human Mass Spec Standard

CAT#: PH308381

NR1H2 MS Standard C13 and N15-labeled recombinant protein (NP_009052)

Product Images

Coomassie blue staining of purified NR1H2 protein (Cat# TP308381). The protein was produced from HEK293T cells transfected with NR1H2 cDNA clone (Cat# RC208381) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208381
• Predicted MW: 51.1 kDa
• Protein Sequence:
  Sequence Link

  >RC208381 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE
  RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK
  CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQ
  GSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQ
  EIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFI
  NPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
  MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009052
• RefSeq Size: 2093
• RefSeq ORF: 1383
• Synonyms: LXR-b; LXRB; NER; NER-I; RIP15; UNR
• Locus ID: 7376
• UniProt ID: P55055, F1D8P7
• Cytogenetics: 19q13.33
• Summary: 'The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).[supplied by OMIM, Jan 2010]'
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors