LXR beta (NR1H2) (NM_007121) Human Recombinant Protein

CAT#: TP308381

Recombinant protein of human nuclear receptor subfamily 1, group H, member 2 (NR1H2)

Product Images

Coomassie blue staining of purified NR1H2 protein (Cat# TP308381). The protein was produced from HEK293T cells transfected with NR1H2 cDNA clone (Cat# RC208381) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208381 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE
  RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK
  CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQ
  GSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQ
  EIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFI
  NPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
  MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Surface Plasmon Ressonance (SPR) (PMID: 27489280)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009052
• Locus ID: 7376
• UniProt ID: P55055, F1D8P7
• Cytogenetics: 19q13.33
• Refseq Size: 2093
• Refseq ORF: 1383
• Synonyms: LXR-b; LXRB; NER; NER-I; RIP15; UNR
• Summary: The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).[supplied by OMIM, Jan 2010]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors