C11orf74 (NM_138787) Human Mass Spec Standard

CAT#: PH308417

C11orf74 MS Standard C13 and N15-labeled recombinant protein (NP_620142)

Product Images

Coomassie blue staining of purified C11orf74 protein (Cat# TP308417). The protein was produced from HEK293T cells transfected with C11orf74 cDNA clone (Cat# RC208417) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208417
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208417 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT
  HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI
  PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK
  DTSPDLEKSCD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620142
• RefSeq Size: 911
• RefSeq ORF: 663
• Synonyms: HEPIS; NWC
• Locus ID: 119710
• UniProt ID: Q86VG3, A8K468
• Cytogenetics: 11p12
• Summary: This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]