IFTAP (NM_138787) Human Recombinant Protein

CAT#: TP308417

Recombinant protein of human chromosome 11 open reading frame 74 (C11orf74)

Product Images

Coomassie blue staining of purified C11orf74 protein (Cat# TP308417). The protein was produced from HEK293T cells transfected with C11orf74 cDNA clone (Cat# RC208417) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208417 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT
  HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI
  PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK
  DTSPDLEKSCD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_620142
• Locus ID: 119710
• UniProt ID: Q86VG3, A8K468
• Cytogenetics: 11p12
• Refseq Size: 911
• Refseq ORF: 663
• Synonyms: C11orf74; HEPIS; NWC
• Summary: This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]