APOL3 (NM_145639) Human Mass Spec Standard

CAT#: PH308643

APOL3 MS Standard C13 and N15-labeled recombinant protein (NP_663614)

Product Images

Coomassie blue staining of purified APOL3 protein (Cat# TP308643). The protein was produced from HEK293T cells transfected with APOL3 cDNA clone (Cat# RC208643) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208643
• Predicted MW: 36.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208643 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYV
  QQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPF
  TAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLL
  NNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLAL
  DVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_663614
• RefSeq Size: 2215
• RefSeq ORF: 993
• Synonyms: apoL-III; APOLIII; CG12_1; CG121
• Locus ID: 80833
• UniProt ID: O95236, A0A024R1G6
• Cytogenetics: 22q12.3
• Summary: This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]