APOL3 (NM_145639) Human Recombinant Protein
CAT#: TP308643
Recombinant protein of human apolipoprotein L, 3 (APOL3), transcript variant alpha/c
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208643 protein sequence
Red=Cloning site Green=Tags(s) MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYV QQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPF TAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLL NNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLAL DVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_663614 |
Locus ID | 80833 |
UniProt ID | O95236, A0A024R1G6 |
Cytogenetics | 22q12.3 |
Refseq Size | 2215 |
Refseq ORF | 993 |
Synonyms | apoL-III; APOLIII; CG12_1; CG121 |
Summary | This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403433 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC407916 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC407939 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC407940 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC410766 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415350 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429418 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429760 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430136 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430137 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403433 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant beta/a |
USD 325.00 |
|
LY407916 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant beta/b |
USD 325.00 |
|
LY407939 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/c |
USD 325.00 |
|
LY407940 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/d |
USD 325.00 |
|
LY410766 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/b |
USD 325.00 |
|
LY415350 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/a |
USD 325.00 |
|
LY429418 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/a |
USD 325.00 |
|
LY429760 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/b |
USD 325.00 |
|
LY430136 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/d |
USD 325.00 |
|
LY430137 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant beta/b |
USD 325.00 |
|
PH308643 | APOL3 MS Standard C13 and N15-labeled recombinant protein (NP_663614) |
USD 2,055.00 |
|
TP761559 | Purified recombinant protein of Human apolipoprotein L, 3 (APOL3), transcript variant beta/a, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review