HIP2 (UBE2K) (NM_005339) Human Mass Spec Standard
CAT#: PH308645
UBE2K MS Standard C13 and N15-labeled recombinant protein (NP_005330)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208645 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC208645 representing NM_005339
Red=Cloning site Green=Tags(s) MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNP PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEM FKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005330 |
RefSeq Size | 2208 |
RefSeq ORF | 600 |
Synonyms | E2-25K; HIP2; HYPG; LIG; UBC1 |
Locus ID | 3093 |
UniProt ID | P61086 |
Cytogenetics | 4p14 |
Summary | 'The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417371 | UBE2K HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426354 | UBE2K HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417371 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 1 |
USD 325.00 |
|
LY426354 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3 |
USD 325.00 |
|
TP308645 | Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 1 |
USD 823.00 |
|
TP720163 | Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3 |
USD 300.00 |
|
TP720982 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review