LAP2 (TMPO) (NM_001032283) Human Mass Spec Standard
CAT#: PH308781
TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208781 |
| Predicted MW | 50.7 kDa |
| Protein Sequence |
>RC208781 protein sequence
Red=Cloning site Green=Tags(s) MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001027454 |
| RefSeq Size | 4186 |
| RefSeq ORF | 1362 |
| Synonyms | CMD1T; LAP2; LEMD4; PRO0868; TP |
| Locus ID | 7112 |
| UniProt ID | P42167, A0A024RBE7, Q59G12 |
| Cytogenetics | 12q23.1 |
| Summary | 'Through alternative splicing, this gene encodes several distinct LEM domain containing protein isoforms. LEM domain proteins include inner nuclear membrane and intranuclear proteins, and are involved in a variety of cellular functions including gene expression, chromatin organization, and replication and cell cycle control. The encoded alpha isoform is broadly diffuse in the nucleus and contains a lamin binding domain, while the beta and gamma isoforms are localized to the nuclear membrane and contain an HDAC3 interaction domain. The distinct isoforms may compete with each other when acting to chaperone other proteins and regulate transcription. [provided by RefSeq, Aug 2019]' |
| Protein Families | Stem cell - Pluripotency, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418798 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422295 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422296 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425526 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418798 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 1 |
USD 665.00 |
|
| LY422295 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 2 |
USD 436.00 |
|
| LY422296 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 |
USD 436.00 |
|
| LY425526 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 |
USD 396.00 |
|
| TP308781 | Recombinant protein of human thymopoietin (TMPO), transcript variant 2 |
USD 867.00 |
|
| TP720158 | Recombinant protein of human thymopoietin (TMPO), transcript variant 2 |
USD 330.00 |
|
| TP761176 | Purified recombinant protein of Human thymopoietin (TMPO), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China