LAP2 (TMPO) (NM_001032283) Human Recombinant Protein
CAT#: TP308781
Recombinant protein of human thymopoietin (TMPO), transcript variant 2
View other "TMPO" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208781 protein sequence
Red=Cloning site Green=Tags(s) MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001027454 |
Locus ID | 7112 |
UniProt ID | P42167, A0A024RBE7, Q59G12 |
Cytogenetics | 12q23.1 |
Refseq Size | 4186 |
Refseq ORF | 1362 |
Synonyms | CMD1T; LAP2; LEMD4; PRO0868; TP |
Summary | Through alternative splicing, this gene encodes several distinct LEM domain containing protein isoforms. LEM domain proteins include inner nuclear membrane and intranuclear proteins, and are involved in a variety of cellular functions including gene expression, chromatin organization, and replication and cell cycle control. The encoded alpha isoform is broadly diffuse in the nucleus and contains a lamin binding domain, while the beta and gamma isoforms are localized to the nuclear membrane and contain an HDAC3 interaction domain. The distinct isoforms may compete with each other when acting to chaperone other proteins and regulate transcription. [provided by RefSeq, Aug 2019] |
Protein Families | Stem cell - Pluripotency, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418798 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422295 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422296 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425526 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418798 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 1 |
USD 605.00 |
|
LY422295 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 2 |
USD 396.00 |
|
LY422296 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 |
USD 396.00 |
|
LY425526 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 |
USD 396.00 |
|
PH308781 | TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454) |
USD 2,055.00 |
|
TP720158 | Recombinant protein of human thymopoietin (TMPO), transcript variant 2 |
USD 330.00 |
|
TP761176 | Purified recombinant protein of Human thymopoietin (TMPO), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review