TXN (NM_003329) Human Mass Spec Standard

CAT#: PH308876

TXN MS Standard C13 and N15-labeled recombinant protein (NP_003320)

Product Images

Coomassie blue staining of purified TXN protein (Cat# TP308876). The protein was produced from HEK293T cells transfected with TXN cDNA clone (Cat# RC208876) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208876
• Predicted MW: 11.7 kDa
• Protein Sequence:
  Sequence Link

  >RC208876 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE
  VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003320
• RefSeq Size: 886
• RefSeq ORF: 315
• Synonyms: TRDX; TRX; TRX1
• Locus ID: 7295
• UniProt ID: P10599, H9ZYJ2
• Cytogenetics: 9q31.3
• Summary: 'The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]'
• Protein Families: Druggable Genome