TXN (NM_003329) Human Recombinant Protein
CAT#: TP308876
Recombinant protein of human thioredoxin (TXN)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208876 protein sequence
Red=Cloning site Green=Tags(s) MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003320 |
Locus ID | 7295 |
UniProt ID | P10599, H9ZYJ2 |
Cytogenetics | 9q31.3 |
Refseq Size | 886 |
Refseq ORF | 315 |
Synonyms | TRDX; TRX; TRX1; Trx80 |
Summary | The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418748 | TXN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418748 | Transient overexpression lysate of thioredoxin (TXN) |
USD 396.00 |
|
PH308876 | TXN MS Standard C13 and N15-labeled recombinant protein (NP_003320) |
USD 2,055.00 |
|
TP720851 | Purified recombinant protein of Human thioredoxin (TXN) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review