Dystrophia myotonica protein kinase (DMPK) (NM_004409) Human Mass Spec Standard
CAT#: PH309151
DMPK MS Standard C13 and N15-labeled recombinant protein (NP_004400)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209151 |
Predicted MW | 69.4 kDa |
Protein Sequence |
>RC209151 protein sequence
Red=Cloning site Green=Tags(s) MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDD FEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVLVNGDRRWITQLHFAFQD ENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIR LADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYA DSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDS VPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREME AIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATDPPSHLDGPPAVAVGQ CPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVVLSRAAALGCIGLVAHAGQLTAVWRRPGAARAP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004400 |
RefSeq Size | 2874 |
RefSeq ORF | 1887 |
Synonyms | DM; DM1; DM1PK; DMK; MDPK; MT-PK |
Locus ID | 1760 |
UniProt ID | Q09013, E5KR06 |
Cytogenetics | 19q13.32 |
Summary | 'The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-38 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2016]' |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418004 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421164 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC421165 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY418004 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 2 |
USD 325.00 |
|
LY421164 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 3 |
USD 495.00 |
|
LY421165 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 4 |
USD 495.00 |
|
PH323643 | DMPK MS Standard C13 and N15-labeled recombinant protein (NP_001075031) |
USD 2,055.00 |
|
TP309151 | Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 2 |
USD 867.00 |
|
TP323643 | Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review