Dystrophia myotonica protein kinase (DMPK) (NM_001081562) Human Mass Spec Standard
CAT#: PH323643
DMPK MS Standard C13 and N15-labeled recombinant protein (NP_001075031)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223643 |
| Predicted MW | 69.4 kDa |
| Protein Sequence |
>RC223643 representing NM_001081562
Red=Cloning site Green=Tags(s) MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDD FEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVLVNGDRRWITQLHFAFQD ENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIR LADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYA DSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDS VPPFTPDFEGATDTCNFDLVEDGLTAMETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTPMELEA EQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREMEAIRTD NQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATDPPSHMAPRPWLWASARWWGQ APCTAATCCSLPGSLGLAYRRRFPCSCSPLFCLVPPPWAALGWWPTPANSPQSGAAQEPPALPEP myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001075031 |
| RefSeq Size | 2873 |
| RefSeq ORF | 1875 |
| Synonyms | DM; DM1; DM1PK; DMK; MDPK; MT-PK |
| Locus ID | 1760 |
| UniProt ID | Q09013, E5KR05 |
| Cytogenetics | 19q13.32 |
| Summary | 'The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-38 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2016]' |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418004 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421164 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC421165 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY418004 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 2 |
USD 436.00 |
|
| LY421164 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 3 |
USD 665.00 |
|
| LY421165 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 4 |
USD 665.00 |
|
| PH309151 | DMPK MS Standard C13 and N15-labeled recombinant protein (NP_004400) |
USD 2,055.00 |
|
| TP309151 | Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 2 |
USD 867.00 |
|
| TP323643 | Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China