Dystrophia myotonica protein kinase (DMPK) (NM_004409) Human Recombinant Protein
CAT#: TP309151
Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 2
View other "DMPK" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209151 protein sequence
Red=Cloning site Green=Tags(s) MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDD FEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVLVNGDRRWITQLHFAFQD ENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIR LADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYA DSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDS VPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREME AIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATDPPSHLDGPPAVAVGQ CPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVVLSRAAALGCIGLVAHAGQLTAVWRRPGAARAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004400 |
Locus ID | 1760 |
UniProt ID | Q09013, E5KR06 |
Cytogenetics | 19q13.32 |
Refseq Size | 2874 |
Refseq ORF | 1887 |
Synonyms | DM; DM1; DM1PK; DMK; MDPK; MT-PK |
Summary | The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-38 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418004 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421164 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421165 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY418004 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 2 |
USD 396.00 |
|
LY421164 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 3 |
USD 605.00 |
|
LY421165 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 4 |
USD 605.00 |
|
PH309151 | DMPK MS Standard C13 and N15-labeled recombinant protein (NP_004400) |
USD 2,055.00 |
|
PH323643 | DMPK MS Standard C13 and N15-labeled recombinant protein (NP_001075031) |
USD 2,055.00 |
|
TP323643 | Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review