REEP1 (NM_022912) Human Mass Spec Standard

CAT#: PH309615

REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063)

Product Images

Coomassie blue staining of purified REEP1 protein (Cat# TP309615). The protein was produced from HEK293T cells transfected with REEP1 cDNA clone (Cat# RC209615) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209615
• Predicted MW: 22.3 kDa
• Protein Sequence:
  Sequence Link

  >RC209615 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKI
  AFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKG
  QGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075063
• RefSeq Size: 3868
• RefSeq ORF: 603
• Synonyms: C2orf23; HMN5B; SPG31; Yip2a
• Locus ID: 65055
• UniProt ID: Q9H902
• Cytogenetics: 2p11.2
• Summary: This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome, Transmembrane