REEP1 (NM_022912) Human Recombinant Protein
CAT#: TP309615
Recombinant protein of human receptor accessory protein 1 (REEP1)
View other "REEP1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209615 protein sequence
Red=Cloning site Green=Tags(s) MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKI AFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKG QGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_075063 |
Locus ID | 65055 |
UniProt ID | Q9H902 |
Cytogenetics | 2p11.2 |
Refseq Size | 3868 |
Refseq ORF | 603 |
Synonyms | C2orf23; HMN5B; SPG31; Yip2a |
Summary | This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411461 | REEP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431110 | REEP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411461 | Transient overexpression lysate of receptor accessory protein 1 (REEP1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
LY431110 | Transient overexpression lysate of receptor accessory protein 1 (REEP1), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 396.00 |
|
PH309615 | REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review