REEP1 (NM_022912) Human Recombinant Protein

CAT#: TP309615

Recombinant protein of human receptor accessory protein 1 (REEP1)

Product Images

Coomassie blue staining of purified REEP1 protein (Cat# TP309615). The protein was produced from HEK293T cells transfected with REEP1 cDNA clone (Cat# RC209615) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209615 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKI
  AFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKG
  QGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075063
• Locus ID: 65055
• UniProt ID: Q9H902
• Cytogenetics: 2p11.2
• Refseq Size: 3868
• Refseq ORF: 603
• Synonyms: C2orf23; HMN5B; SPG31; Yip2a
• Summary: This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome, Transmembrane