SPARC (NM_003118) Human Mass Spec Standard

CAT#: PH309964

SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109)

Product Images

Coomassie blue staining of purified SPARC protein (Cat# TP309964). The protein was produced from HEK293T cells transfected with SPARC cDNA clone (Cat# RC209964) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209964
• Predicted MW: 34.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209964 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN
  PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK
  LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD
  HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY
  IALDEWAGCFGIKQKDIDKDLVI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003109
• RefSeq Size: 3604
• RefSeq ORF: 909
• Synonyms: BM-40; OI17; ON
• Locus ID: 6678
• UniProt ID: P09486
• Cytogenetics: 5q33.1
• Summary: 'This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]'
• Protein Families: Druggable Genome