SPARC (NM_003118) Human Recombinant Protein
CAT#: TP723420
Purified recombinant protein of Human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC).
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | CHO |
| Expression cDNA Clone or AA Sequence |
APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
|
| Tag | Tag Free |
| Predicted MW | 43.7 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to increase alkaline phosphatase activity in differentiating MC3T3 cells using a concentration of 0.5-0.7ug/mL. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003109 |
| Locus ID | 6678 |
| UniProt ID | P09486 |
| Cytogenetics | 5q33.1 |
| Refseq Size | 3604 |
| Refseq ORF | 909 |
| Synonyms | BM-40; OI17; ON |
| Summary | 'This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418873 | SPARC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418873 | Transient overexpression lysate of secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) |
USD 396.00 |
|
| PH309964 | SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109) |
USD 2,055.00 |
|
| TP309964 | Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) |
USD 439.00 |
|
| TP720332 | Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China