SPARC (NM_003118) Human Recombinant Protein

CAT#: TP309964

Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC)

Product Images

Coomassie blue staining of purified SPARC protein (Cat# TP309964). The protein was produced from HEK293T cells transfected with SPARC cDNA clone (Cat# RC209964) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209964 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN
  PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK
  LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD
  HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY
  IALDEWAGCFGIKQKDIDKDLVI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003109
• Locus ID: 6678
• UniProt ID: P09486
• Cytogenetics: 5q33.1
• Refseq Size: 3604
• Refseq ORF: 909
• Synonyms: BM-40; OI17; ON; ONT
• Summary: This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]
• Protein Families: Druggable Genome