CCL3 (NM_002983) Human Mass Spec Standard

CAT#: PH310026

CCL3 MS Standard C13 and N15-labeled recombinant protein (NP_002974)

Product Images

Coomassie blue staining of purified CCL3 protein (Cat# TP310026). The protein was produced from HEK293T cells transfected with CCL3 cDNA clone (Cat# RC210026) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210026
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Sequence Link

  >RC210026 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR
  QVCADPSEEWVQKYVSDLELSA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002974
• RefSeq Size: 813
• RefSeq ORF: 276
• Synonyms: G0S19-1; LD78ALPHA; MIP-1-alpha; MIP1A; SCYA3
• Locus ID: 6348
• UniProt ID: P10147, A0N0R1
• Cytogenetics: 17q12
• Summary: 'This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway