CCL3 (NM_002983) Human Recombinant Protein
CAT#: TP723303
Purified recombinant protein of Human chemokine (C-C motif) ligand 3 (CCL3).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
|
| Tag | Tag Free |
| Predicted MW | 7.8 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002974 |
| Locus ID | 6348 |
| UniProt ID | P10147, A0N0R1 |
| Cytogenetics | 17q12 |
| Refseq Size | 813 |
| Refseq ORF | 276 |
| Synonyms | G0S19-1; LD78ALPHA; MIP-1-alpha; MIP1A; SCYA3 |
| Summary | 'This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418970 | CCL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418970 | Transient overexpression lysate of chemokine (C-C motif) ligand 3 (CCL3) |
USD 436.00 |
|
| PH310026 | CCL3 MS Standard C13 and N15-labeled recombinant protein (NP_002974) |
USD 2,055.00 |
|
| TP310026 | Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3) |
USD 823.00 |
|
| TP720049 | Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3) |
USD 330.00 |
|
| TP790113 | Purified recombinant protein of Human chemokine (C-C motif) ligand 3 (CCL3), esidues 24-92aa, with N-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 719.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China