CCL3 (NM_002983) Human Recombinant Protein
CAT#: TP310026
Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3)
View other "CCL3" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210026 protein sequence
Red=Cloning site Green=Tags(s) MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR QVCADPSEEWVQKYVSDLELSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002974 |
Locus ID | 6348 |
UniProt ID | P10147, A0N0R1 |
Cytogenetics | 17q12 |
Refseq Size | 813 |
Refseq ORF | 276 |
Synonyms | G0S19-1; LD78ALPHA; MIP-1-alpha; MIP1A; SCYA3 |
Summary | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418970 | CCL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418970 | Transient overexpression lysate of chemokine (C-C motif) ligand 3 (CCL3) |
USD 396.00 |
|
PH310026 | CCL3 MS Standard C13 and N15-labeled recombinant protein (NP_002974) |
USD 2,055.00 |
|
TP720049 | Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3) |
USD 330.00 |
|
TP723303 | Purified recombinant protein of Human chemokine (C-C motif) ligand 3 (CCL3). |
USD 240.00 |
|
TP790113 | Purified recombinant protein of Human chemokine (C-C motif) ligand 3 (CCL3), esidues 24-92aa, with N-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 719.00 |
{0} Product Review(s)
Be the first one to submit a review