PRRX1 (NM_022716) Human Mass Spec Standard
CAT#: PH310393
PRRX1 MS Standard C13 and N15-labeled recombinant protein (NP_073207)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210393 |
Predicted MW | 27.3 kDa |
Protein Sequence |
>RC210393 protein sequence
Red=Cloning site Green=Tags(s) MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCA NNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_073207 |
RefSeq Size | 3999 |
RefSeq ORF | 735 |
Synonyms | AGOTC; PHOX1; PMX1; PRX-1; PRX1 |
Locus ID | 5396 |
UniProt ID | P54821 |
Cytogenetics | 1q24.2 |
Summary | 'The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq, Jul 2008]' |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411607 | PRRX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416343 | PRRX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411607 | Transient overexpression lysate of paired related homeobox 1 (PRRX1), transcript variant pmx-1b |
USD 396.00 |
|
LY416343 | Transient overexpression lysate of paired related homeobox 1 (PRRX1), transcript variant pmx-1a |
USD 396.00 |
|
PH313276 | PRRX1 MS Standard C13 and N15-labeled recombinant protein (NP_008833) |
USD 2,055.00 |
|
TP310393 | Recombinant protein of human paired related homeobox 1 (PRRX1), transcript variant pmx-1b |
USD 823.00 |
|
TP313276 | Recombinant protein of human paired related homeobox 1 (PRRX1), transcript variant pmx-1a |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review