PRRX1 (NM_006902) Human Mass Spec Standard

CAT#: PH313276

PRRX1 MS Standard C13 and N15-labeled recombinant protein (NP_008833)

Product Images

Coomassie blue staining of purified PRRX1 protein (Cat# TP313276). The protein was produced from HEK293T cells transfected with PRRX1 cDNA clone (Cat# RC213276) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213276
• Predicted MW: 24.2 kDa
• Protein Sequence:
  Sequence Link

  >RC213276 representing NM_006902
  Red=Cloning site Green=Tags(s)
  
  MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL
  TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV
  WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLH
  EGLHNGF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008833
• RefSeq Size: 4071
• RefSeq ORF: 651
• Synonyms: AGOTC; PHOX1; PMX1; PRX-1; PRX1
• Locus ID: 5396
• UniProt ID: P54821
• Cytogenetics: 1q24.2
• Summary: 'The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors