PRRX1 (NM_022716) Human Recombinant Protein

CAT#: TP310393

Recombinant protein of human paired related homeobox 1 (PRRX1), transcript variant pmx-1b

Product Images

Coomassie blue staining of purified PRRX1 protein (Cat# TP310393). The protein was produced from HEK293T cells transfected with PRRX1 cDNA clone (Cat# RC210393) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210393 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL
  TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV
  WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCA
  NNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_073207
• Locus ID: 5396
• UniProt ID: P54821
• Cytogenetics: 1q24.2
• Refseq Size: 3999
• Refseq ORF: 735
• Synonyms: AGOTC; PHOX1; PMX1; PRX-1; PRX1
• Summary: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors