OIF (OGN) (NM_014057) Human Mass Spec Standard

CAT#: PH310651

OGN MS Standard C13 and N15-labeled recombinant protein (NP_054776)

Product Images

Coomassie blue staining of purified OGN protein (Cat# TP310651). The protein was produced from HEK293T cells transfected with OGN cDNA clone (Cat# RC210651) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210651
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC210651 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS
  LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA
  DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK
  KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG
  KHPNSFICLKRLPIGSYF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054776
• RefSeq Size: 2786
• RefSeq ORF: 894
• Synonyms: OG; OIF; SLRR3A
• Locus ID: 4969
• UniProt ID: P20774, A8K0R3, Q7Z532, B4DI63
• Cytogenetics: 9q22.31
• Summary: 'This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]'
• Protein Families: Secreted Protein