OIF (OGN) (NM_014057) Human Mass Spec Standard
CAT#: PH310651
OGN MS Standard C13 and N15-labeled recombinant protein (NP_054776)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210651 |
Predicted MW | 33.9 kDa |
Protein Sequence |
>RC210651 protein sequence
Red=Cloning site Green=Tags(s) MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG KHPNSFICLKRLPIGSYF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_054776 |
RefSeq Size | 2786 |
RefSeq ORF | 894 |
Synonyms | OG; OIF; SLRR3A |
Locus ID | 4969 |
UniProt ID | P20774, A8K0R3, Q7Z532, B4DI63 |
Cytogenetics | 9q22.31 |
Summary | 'This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403216 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC411273 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC415500 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429730 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403216 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 1 |
USD 396.00 |
|
LY411273 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 2 |
USD 396.00 |
|
LY415500 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 3 |
USD 396.00 |
|
LY429730 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 2 |
USD 396.00 |
|
PH323948 | OGN MS Standard C13 and N15-labeled recombinant protein (NP_148935) |
USD 2,055.00 |
|
TP310651 | Recombinant protein of human osteoglycin (OGN), transcript variant 3 |
USD 439.00 |
|
TP323948 | Recombinant protein of human osteoglycin (OGN), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review