OIF (OGN) (NM_014057) Human Recombinant Protein

CAT#: TP310651

Recombinant protein of human osteoglycin (OGN), transcript variant 3

Product Images

Coomassie blue staining of purified OGN protein (Cat# TP310651). The protein was produced from HEK293T cells transfected with OGN cDNA clone (Cat# RC210651) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210651 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS
  LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA
  DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK
  KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG
  KHPNSFICLKRLPIGSYF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054776
• Locus ID: 4969
• UniProt ID: P20774, A8K0R3, Q7Z532, B4DI63
• Cytogenetics: 9q22.31
• Refseq Size: 2786
• Refseq ORF: 894
• Synonyms: OG; OIF; SLRR3A
• Summary: This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• Protein Families: Secreted Protein