Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Mass Spec Standard

CAT#: PH310717

PSMA5 MS Standard C13 and N15-labeled recombinant protein (NP_002781)

Product Images

Coomassie blue staining of purified PSMA5 protein (Cat# TP310717). The protein was produced from HEK293T cells transfected with PSMA5 cDNA clone (Cat# RC210717) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210717
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC210717 representing NM_002790
  Red=Cloning site Green=Tags(s)
  
  MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI
  DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVA
  LLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKL
  NATNIELATVQPGQNFHMFTKEELEEVIKDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002781
• RefSeq Size: 1023
• RefSeq ORF: 723
• Synonyms: PSC5; ZETA
• Locus ID: 5686
• UniProt ID: P28066, A0A109NGN6
• Cytogenetics: 1p13.3
• Summary: 'The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]'
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome