Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Recombinant Protein
CAT#: TP310717
Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5)
View other "PSMA5" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210717 representing NM_002790
Red=Cloning site Green=Tags(s) MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVA LLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKL NATNIELATVQPGQNFHMFTKEELEEVIKDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002781 |
Locus ID | 5686 |
UniProt ID | P28066, A0A109NGN6 |
Cytogenetics | 1p13.3 |
Refseq Size | 1023 |
Refseq ORF | 723 |
Synonyms | PSC5; ZETA |
Summary | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419118 | PSMA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419118 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5) |
USD 396.00 |
|
PH310717 | PSMA5 MS Standard C13 and N15-labeled recombinant protein (NP_002781) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review