Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Recombinant Protein

CAT#: TP310717

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5)

Product Images

Coomassie blue staining of purified PSMA5 protein (Cat# TP310717). The protein was produced from HEK293T cells transfected with PSMA5 cDNA clone (Cat# RC210717) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210717 representing NM_002790
  Red=Cloning site Green=Tags(s)
  
  MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI
  DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVA
  LLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKL
  NATNIELATVQPGQNFHMFTKEELEEVIKDI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002781
• Locus ID: 5686
• UniProt ID: P28066, A0A109NGN6
• Cytogenetics: 1p13.3
• Refseq Size: 1023
• Refseq ORF: 723
• Synonyms: PSC5; ZETA
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome