ENT2 (SLC29A2) (NM_001532) Human Mass Spec Standard

CAT#: PH310776

SLC29A2 MS Standard C13 and N15-labeled recombinant protein (NP_001523)

Product Images

Coomassie blue staining of purified SLC29A2 protein (Cat# TP310776). The protein was produced from HEK293T cells transfected with SLC29A2 cDNA clone (Cat# RC210776) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210776
• Predicted MW: 50.1 kDa
• Protein Sequence:
  Sequence Link

  >RC210776 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNW
  VTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMSPGPFFSITMASVCFINSF
  SAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFITPCVGILMSIVCY
  LSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGK
  PSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSY
  FLWPDEDSRLLPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR
  QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001523
• RefSeq Size: 2529
• RefSeq ORF: 1368
• Synonyms: DER12; ENT2; HNP36
• Locus ID: 3177
• UniProt ID: Q14542, Q96FB2
• Cytogenetics: 11q13.2
• Summary: 'The uptake of nucleosides by transporters, such as SLC29A2, is essential for nucleotide synthesis by salvage pathways in cells that lack de novo biosynthetic pathways. Nucleoside transport also plays a key role in the regulation of many physiologic processes through its effect on adenosine concentration at the cell surface (Griffiths et al., 1997 [PubMed 9396714]).[supplied by OMIM, Nov 2008]'
• Protein Families: Transmembrane