Resistin (RETN) (NM_020415) Human Mass Spec Standard
CAT#: PH310942
RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210942 |
| Predicted MW | 11.4 kDa |
| Protein Sequence |
>RC210942 protein sequence
Red=Cloning site Green=Tags(s) MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_065148 |
| RefSeq Size | 478 |
| RefSeq ORF | 324 |
| Synonyms | ADSF; FIZZ3; RETN1; RSTN; XCP1 |
| Locus ID | 56729 |
| UniProt ID | Q9HD89 |
| Cytogenetics | 19p13.2 |
| Summary | This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402786 | RETN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402786 | Transient overexpression lysate of resistin (RETN) |
USD 436.00 |
|
| TP310942 | Recombinant protein of human resistin (RETN) |
USD 823.00 |
|
| TP720988 | Purified recombinant protein of Human resistin (RETN), transcript variant 1 |
USD 330.00 |
|
| TP723382 | Purified recombinant protein of Human resistin (RETN), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China