Resistin (RETN) (NM_020415) Human Mass Spec Standard

CAT#: PH310942

RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148)

Product Images

Coomassie blue staining of purified RETN protein (Cat# TP310942). The protein was produced from HEK293T cells transfected with RETN cDNA clone (Cat# RC210942) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210942
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Sequence Link

  >RC210942 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT
  GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065148
• RefSeq Size: 478
• RefSeq ORF: 324
• Synonyms: ADSF; FIZZ3; RETN1; RSTN; XCP1
• Locus ID: 56729
• UniProt ID: Q9HD89
• Cytogenetics: 19p13.2
• Summary: This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]
• Protein Families: Druggable Genome, Secreted Protein