Resistin (RETN) (NM_020415) Human Recombinant Protein

CAT#: TP723382

Purified recombinant protein of Human resistin (RETN), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
• Tag: Tag Free
• Predicted MW: 19.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to stimulate lipolysis in cultured human adipocytes. (Ort, T. et al. Endocrinology; 46(5):2200-9)
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065148
• Locus ID: 56729
• UniProt ID: Q9HD89
• Cytogenetics: 19p13.2
• Refseq Size: 478
• Refseq ORF: 324
• Synonyms: ADSF; FIZZ3; RETN1; RSTN; XCP1
• Summary: This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]
• Protein Families: Druggable Genome, Secreted Protein