Resistin (RETN) (NM_020415) Human Recombinant Protein
CAT#: TP720988
Purified recombinant protein of Human resistin (RETN), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH
|
Tag | C-His |
Predicted MW | 10.6 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM Acetic acid,pH 3.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_065148 |
Locus ID | 56729 |
UniProt ID | Q9HD89 |
Cytogenetics | 19p13.2 |
Refseq Size | 478 |
Refseq ORF | 324 |
Synonyms | ADSF; FIZZ3; RETN1; RSTN; XCP1 |
Summary | This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402786 | RETN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402786 | Transient overexpression lysate of resistin (RETN) |
USD 325.00 |
|
PH310942 | RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148) |
USD 2,055.00 |
|
TP310942 | Recombinant protein of human resistin (RETN) |
USD 823.00 |
|
TP723382 | Purified recombinant protein of Human resistin (RETN), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review